PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN31497.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 200aa    MW: 22616.5 Da    PI: 9.785
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN31497.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-17552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
       KHN31497.1  5 KGPWTAEEDQILVSHIQRYGHGNWRALPKQAGLLRCGKSCRLRWINYL 52
                     79******************************99************97 PP

2Myb_DNA-binding51.42.5e-1658103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia+ ++ gRt++++k++w+++l
       KHN31497.1  58 RGKFSKEEEDTILKLHGILGNR-WSAIAASLP-GRTDNEIKNFWHTHL 103
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.548152IPR017930Myb domain
SuperFamilySSF466894.21E-31199IPR009057Homeodomain-like
SMARTSM007175.8E-14454IPR001005SANT/Myb domain
PfamPF002497.8E-16552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-24659IPR009057Homeodomain-like
CDDcd001672.03E-11752No hitNo description
PROSITE profilePS5129425.71553107IPR017930Myb domain
SMARTSM007177.6E-1657105IPR001005SANT/Myb domain
PfamPF002493.6E-1558103IPR001005SANT/Myb domain
CDDcd001672.29E-1160103No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2660107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGLKKGPWTA EEDQILVSHI QRYGHGNWRA LPKQAGLLRC GKSCRLRWIN YLRPDIKRGK  60
FSKEEEDTIL KLHGILGNRW SAIAASLPGR TDNEIKNFWH THLKKRIQKS GVHNGNPSSR  120
ILQEAQANTS SNASSVMIAN YGLPSRNINP PIAGFYGAVS SDTFGEIKDN HGSCQLSEEM  180
EFWYNIYSSN QGKHHETMEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-29310725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521771.21e-139PREDICTED: LOW QUALITY PROTEIN: myb-related protein Myb4
SwissprotQ7XBH44e-68MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0B2RI561e-149A0A0B2RI56_GLYSO; Myb-related protein Myb4
STRINGGLYMA03G41100.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-65myb domain protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]